logo

Crowdly

The following peptide sequence was deemed too long to be easily assessed by mas...

✅ The verified answer to this question is available below. Our community-reviewed solutions help you understand the material better.

The following peptide sequence was deemed too long to be easily assessed by mass spectrometry. Therefore, it was first digested with trypsin. In the box below, enter the amino acid sequence (use the single letter code; do not enter spaces or non-amino acid characters) of any ONE possible tryptic peptide that may have been detected by the mass spectrometer.

VQSYEKEEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVQTFPF
More questions like this

Want instant access to all verified answers on learning.monash.edu?

Get Unlimited Answers To Exam Questions - Install Crowdly Extension Now!