logo

Crowdly

Browser

Додати до Chrome

BCH2011 - Structure and function of cellular biomolecules - S1 2025

Шукаєте відповіді та рішення тестів для BCH2011 - Structure and function of cellular biomolecules - S1 2025? Перегляньте нашу велику колекцію перевірених відповідей для BCH2011 - Structure and function of cellular biomolecules - S1 2025 в learning.monash.edu.

Отримайте миттєвий доступ до точних відповідей та детальних пояснень для питань вашого курсу. Наша платформа, створена спільнотою, допомагає студентам досягати успіху!

The following peptide sequence was deemed too long to be easily assessed by mass spectrometry. Therefore, it was first digested with trypsin. In the box below, enter the amino acid sequence (use the single letter code; do not enter spaces or non-amino acid characters) of any ONE possible tryptic peptide that may have been detected by the mass spectrometer.

VPLSYLLSRGQQVKVVSQLLRQAMHEGLLMPVVKSEGGEDYTGATVIGPLKGVPPQD
Переглянути це питання

SDS-PAGE is an essential technique for separating proteins. Separation occurs predominantly due to differences in protein:

0%
0%
0%
0%
Переглянути це питання

The technique of Edman degradation is useful for sequencing a protein/peptide from:

Переглянути це питання

The image below is a representation of an acid-base titration of a diprotic amino acid, labelled at specific points (i through v).

Which region corresponds to the pH being equal to the pKa of the protonated amino group?

Image failed to load: AA titration

Переглянути це питання

In attempting to define the subunit composition of an unknown protein, you decide to subject the protein to SDS-PAGE in the presence or absence of the reducing agent DTT. The results of this analysis are shown below.

Lane 1: molecular weight marker ladder.

Lane 2: protein sample without DTT

Lane 3: protein sample with DTT.

Image failed to load: SDS-PAGE2

From this analysis, what is the subunit composition of the original native protein?

Переглянути це питання

A sample containing an unknown polypeptide of 20 amino acids was assessed through a combination of Edman degradation and tryptic digest with mass spectrometry.

The Edman degradation result showed a peptide sequence of: MMFSRVNMLKM

The tryptic digest and mass spectrometry result showed peptide/amino acid sequences of: 

VNMLK and MMFSR and A and MLLATVLLR 

What is the complete polypeptide sequence?

(Use the single letter amino acid code, with no spaces or non-amino acid characters)

 
Переглянути це питання

The image below is a representation of an acid-base titration of a diprotic amino acid, labelled at specific points (i through v).

Which region(s) have maximum pH buffering capacity?

Image failed to load: AA titration

Переглянути це питання

SDS-PAGE is an essential technique for separating proteins. Which ONE of the following statements is true?

Переглянути це питання

Amino acids have characteristic titration curves. A plot of the titration of an amino acid (bearing a non-ionisable side chain) with a strong base will result in two distinct phases, corresponding to:

0%
0%
0%
0%
Переглянути це питання

Consider that you wish to separate a mixture of arginine, glutamate and valine by ion exhange chromatography.

Using a cation exchange column at pH 6, which amino acid would you expect to elute first and which last?

pKa and pI values are as follows:

Arginine: pK1 = 2.17, pK2 = 9.04, pKR = 12.48, pI = 10.76

Glutamate: pK1 = 2.19, pK2 = 9.67, pKR = 4.25, pI = 3.22

Valine: pK1 = 2.32, pK2 = 9.62, pI = 5.97

 

Переглянути це питання

Хочете миттєвий доступ до всіх перевірених відповідей на learning.monash.edu?

Отримайте необмежений доступ до відповідей на екзаменаційні питання - встановіть розширення Crowdly зараз!

Browser

Додати до Chrome