✅ Перевірена відповідь на це питання доступна нижче. Наші рішення, перевірені спільнотою, допомагають краще зрозуміти матеріал.
The following peptide sequence was deemed too long to be easily assessed by mass spectrometry. Therefore, any disulphide bonds were reduced and the peptide was digested with trypsin. In the box below, enter the amino acid sequence (use the single letter code; do not enter spaces or non-amino acid characters) of any ONE possible tryptic peptide that may have been detected by the mass spectrometer.
VSANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVESKYTVENGYSTSAОтримайте необмежений доступ до відповідей на екзаменаційні питання - встановіть розширення Crowdly зараз!